PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G216600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YB
Protein Properties Length: 207aa    MW: 22508.5 Da    PI: 7.5074
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G216600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.15.5e-5870166197
               NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                         vreqdr+lPian+srimkk+lPan+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfedy++plkvyl++yr
  Potri.010G216600.1  70 VREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIDPLKVYLARYR 160
                         69***************************************************************************************** PP

               NF-YB  92 elegek 97 
                         eleg+ 
  Potri.010G216600.1 161 ELEGDA 166
                         ***996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.3E-5465180IPR009072Histone-fold
SuperFamilySSF471137.14E-4073177IPR009072Histone-fold
PfamPF008083.0E-2876140IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.6E-20104122No hitNo description
PROSITE patternPS006850107123IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.6E-20123141No hitNo description
PRINTSPR006151.6E-20142160No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
LFSIVRSKNF SFFLSLFLPL SLQLSRQIQN HPLLSLFLSP GFLSEMADNP TSPAAGSHES  60
GGEQSPRSGV REQDRYLPIA NISRIMKKAL PANGKIAKDA KDTVQECVSE FISFVTSEAS  120
DKCQKEKRKT INGDDLLWAM ATLGFEDYID PLKVYLARYR ELEGDAKGSA RGGDGSSKRE  180
AVGGLPAQNA QGQGQHMILP SMQGNE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A9e-4771161393NF-YB
4awl_B9e-4771161494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A9e-4771161494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.17271e-165bud| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011038892.11e-114PREDICTED: nuclear transcription factor Y subunit B-1 isoform X3
SwissprotQ8VYK44e-77NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLB9SD431e-106B9SD43_RICCO; Ccaat-binding transcription factor subunit A, putative
STRINGPOPTR_0008s04440.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.33e-78nuclear factor Y, subunit B8